Ver mas grande
CSF3 (Human) Recombinant Protein
AB-P4388
Producto nuevo
CSF3 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | CSF3 |
| Gene Alias | G-CSF|GCSF|MGC45931 |
| Gene Description | colony stimulating factor 3 (granulocyte) |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC or lower.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Storage Buffer | Lyophilized from 10 mM sodium citrate, pH 3.0 |
| Gene ID | 1440 |
Más información
Human CSF3 (P09919) recombinant protein expressed in Escherichia coli.