CSF3 (Human) Recombinant Protein
  • CSF3 (Human) Recombinant Protein

CSF3 (Human) Recombinant Protein

Ref: AB-P4388
CSF3 (Human) Recombinant Protein

Información del producto

Human CSF3 (P09919) recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name CSF3
Gene Alias G-CSF|GCSF|MGC45931
Gene Description colony stimulating factor 3 (granulocyte)
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C or lower.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Form Lyophilized
Antigen species Target species Human
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer Lyophilized from 10 mM sodium citrate, pH 3.0
Gene ID 1440

Enviar uma mensagem


CSF3 (Human) Recombinant Protein

CSF3 (Human) Recombinant Protein