Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
CSF3 (Human) Recombinant Protein
Abnova
CSF3 (Human) Recombinant Protein
Ref: AB-P4388
CSF3 (Human) Recombinant Protein
Contacte-nos
Información del producto
Human CSF3 (P09919) recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
10 ug
Gene Name
CSF3
Gene Alias
G-CSF|GCSF|MGC45931
Gene Description
colony stimulating factor 3 (granulocyte)
Storage Conditions
Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C or lower.
Aliquot to avoid repeated freezing and thawing.
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Form
Lyophilized
Antigen species Target species
Human
Quality control testing
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer
Lyophilized from 10 mM sodium citrate, pH 3.0
Gene ID
1440
Enviar uma mensagem
CSF3 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*