EGF (Human) Recombinant Protein
  • EGF (Human) Recombinant Protein

EGF (Human) Recombinant Protein

Ref: AB-P4381
EGF (Human) Recombinant Protein

Información del producto

Human EGF (P01133) recombinant protein expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name EGF
Gene Alias HOMG4|URG
Gene Description epidermal growth factor (beta-urogastrone)
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C or lower.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Form Lyophilized
Antigen species Target species Human
Storage Buffer No additive
Gene ID 1950

Enviar un mensaje


EGF (Human) Recombinant Protein

EGF (Human) Recombinant Protein