View larger
Human EGF (P01133) recombinant protein expressed in <i>Escherichia coli</i>.
AB-P4381
New product
EGF (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 500 ug |
| Gene Name | EGF |
| Gene Alias | HOMG4|URG |
| Gene Description | epidermal growth factor (beta-urogastrone) |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC or lower.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | No additive |
| Gene ID | 1950 |
More info
Human EGF (P01133) recombinant protein expressed in Escherichia coli.