Ccl21a (Mouse) Recombinant Protein Ver mas grande

Ccl21a (Mouse) Recombinant Protein

AB-P4353

Producto nuevo

Ccl21a (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 20 ug
Gene Name Ccl21a
Gene Alias 6CKBAC2|6Ckine|ALP|AW987545|CKb9|MGC107632|SCYA21a|SLC|Scya21|Scya21b|Tca4|plt
Gene Description chemokine (C-C motif) ligand 21A
Storage Conditions Store at -20ºC on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS
Gene ID 18829

Más información

Mouse Ccl21a (P84444, 24 a.a. - 133 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Ccl21a (Mouse) Recombinant Protein

Ccl21a (Mouse) Recombinant Protein