Ver mas grande
Ccl21a (Mouse) Recombinant Protein
AB-P4353
Producto nuevo
Ccl21a (Mouse) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | Ccl21a |
| Gene Alias | 6CKBAC2|6Ckine|ALP|AW987545|CKb9|MGC107632|SCYA21a|SLC|Scya21|Scya21b|Tca4|plt |
| Gene Description | chemokine (C-C motif) ligand 21A |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from PBS |
| Gene ID | 18829 |
Más información
Mouse Ccl21a (P84444, 24 a.a. - 133 a.a.) partial recombinant protein expressed in Escherichia coli.