Ccl21a (Mouse) Recombinant Protein
  • Ccl21a (Mouse) Recombinant Protein

Ccl21a (Mouse) Recombinant Protein

Ref: AB-P4353
Ccl21a (Mouse) Recombinant Protein

Información del producto

Mouse Ccl21a (P84444, 24 a.a. - 133 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Ccl21a
Gene Alias 6CKBAC2|6Ckine|ALP|AW987545|CKb9|MGC107632|SCYA21a|SLC|Scya21|Scya21b|Tca4|plt
Gene Description chemokine (C-C motif) ligand 21A
Storage Conditions Store at -20C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS
Gene ID 18829

Enviar uma mensagem


Ccl21a (Mouse) Recombinant Protein

Ccl21a (Mouse) Recombinant Protein