Ver mas grande
Prmt1 (Mouse) Recombinant Protein
AB-P4330
Producto nuevo
Prmt1 (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | Prmt1 |
| Gene Alias | 6720434D09Rik|AW214366|Hrmt1l2|Mrmt1 |
| Gene Description | protein arginine N-methyltransferase 1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MHHHHHHMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVL |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 40 mM Tris, 100 mM NaCl, 4 mM MgCl2, pH 8.0 (40% glycerol, 2 mM DTT). |
| Gene ID | 15469 |
Más información
Mouse Prmt1 (AAF37293, 1 a.a. - 353 a.a.) full-length recombinant protein with His-MBP tag expressed in Escherichia coli.