AB-P4330
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Size | 100 ug |
Gene Name | Prmt1 |
Gene Alias | 6720434D09Rik|AW214366|Hrmt1l2|Mrmt1 |
Gene Description | protein arginine N-methyltransferase 1 |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Concentration | 1 mg/mL |
Application Key | Func,SDS-PAGE |
Immunogen Prot. Seq | MHHHHHHMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVL |
Form | Liquid |
Antigen species Target species | Mouse |
Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
Storage Buffer | In 40 mM Tris, 100 mM NaCl, 4 mM MgCl2, pH 8.0 (40% glycerol, 2 mM DTT). |
Gene ID | 15469 |