Adipoq (Mouse) Recombinant Protein Ver mas grande

Adipoq (Mouse) Recombinant Protein

AB-P4329

Producto nuevo

Adipoq (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name Adipoq
Gene Alias 30kDa|APN|Acdc|Acrp30|GBP28|adipo|apM1
Gene Description adiponectin, C1Q and collagen domain containing
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMEDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Form Liquid
Antigen species Target species Mouse
Quality control testing 15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 20 mM Tris, pH 8.0 (1 mM DTT, 10% glycerol).
Gene ID 11450

Más información

Mouse Adipoq (NP_033735, 18 a.a. - 247 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.

Consulta sobre un producto

Adipoq (Mouse) Recombinant Protein

Adipoq (Mouse) Recombinant Protein