Adipoq (Mouse) Recombinant Protein
  • Adipoq (Mouse) Recombinant Protein

Adipoq (Mouse) Recombinant Protein

Ref: AB-P4329
Adipoq (Mouse) Recombinant Protein

Información del producto

Mouse Adipoq (NP_033735, 18 a.a. - 247 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name Adipoq
Gene Alias 30kDa|APN|Acdc|Acrp30|GBP28|adipo|apM1
Gene Description adiponectin, C1Q and collagen domain containing
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMEDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Form Liquid
Antigen species Target species Mouse
Quality control testing 15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 20 mM Tris, pH 8.0 (1 mM DTT, 10% glycerol).
Gene ID 11450

Enviar uma mensagem


Adipoq (Mouse) Recombinant Protein

Adipoq (Mouse) Recombinant Protein