Ver mas grande
IL12B (Human) Recombinant Protein
AB-P3813
Producto nuevo
IL12B (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | IL12B |
| Gene Alias | CLMF|CLMF2|IL-12B|NKSF|NKSF2 |
| Gene Description | interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) |
| Storage Conditions | Store at -20ºC. For long term storage store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQV |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 10% SDS-PAGE Result |
| Storage Buffer | In PBS (50% glycerol) |
| Gene ID | 3593 |
Más información
Human IL12B (NP_002178.2, 23 a.a. - 328 a.a.) partial recombinant protein expressed in Escherichia coli.