IL12B (Human) Recombinant Protein
  • IL12B (Human) Recombinant Protein

IL12B (Human) Recombinant Protein

Ref: AB-P3813
IL12B (Human) Recombinant Protein

Información del producto

Human IL12B (NP_002178.2, 23 a.a. - 328 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IL12B
Gene Alias CLMF|CLMF2|IL-12B|NKSF|NKSF2
Gene Description interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40)
Storage Conditions Store at -20C. For long term storage store at -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQV
Form Liquid
Antigen species Target species Human
Quality control testing 10% SDS-PAGE Result
Storage Buffer In PBS (50% glycerol)
Gene ID 3593

Enviar uma mensagem


IL12B (Human) Recombinant Protein

IL12B (Human) Recombinant Protein