View larger
Human IL12B (NP_002178.2, 23 a.a. - 328 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P3813
New product
IL12B (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | IL12B |
| Gene Alias | CLMF|CLMF2|IL-12B|NKSF|NKSF2 |
| Gene Description | interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) |
| Storage Conditions | Store at -20ºC. For long term storage store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQV |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 10% SDS-PAGE Result |
| Storage Buffer | In PBS (50% glycerol) |
| Gene ID | 3593 |
More info
Human IL12B (NP_002178.2, 23 a.a. - 328 a.a.) partial recombinant protein expressed in Escherichia coli.