Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
IL12B (Human) Recombinant Protein
Abnova
IL12B (Human) Recombinant Protein
Ref: AB-P3813
IL12B (Human) Recombinant Protein
Contacte-nos
Información del producto
Human IL12B (NP_002178.2, 23 a.a. - 328 a.a.) partial recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
10 ug
Gene Name
IL12B
Gene Alias
CLMF|CLMF2|IL-12B|NKSF|NKSF2
Gene Description
interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40)
Storage Conditions
Store at -20C. For long term storage store at -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key
SDS-PAGE
Immunogen Prot. Seq
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQV
Form
Liquid
Antigen species Target species
Human
Quality control testing
10% SDS-PAGE Result
Storage Buffer
In PBS (50% glycerol)
Gene ID
3593
Enviar uma mensagem
IL12B (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*