Ver mas grande
CXorf27 (Human) Recombinant Protein
AB-P3794
Producto nuevo
CXorf27 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | CXorf27 |
| Gene Alias | 1700054O13Rik|HIP17|HYPM |
| Gene Description | chromosome X open reading frame 27 |
| Storage Conditions | Store at -20ºC. <br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MSEKKNCKNSSTNNNQTQDPSRNELQVPRSFVDRVVQDERDVQSQSSSTINTLLTLLDCLADYIMERVGLEASNNGSMRNTSQDREREVDNNREPHSAESDVTRFLFDEMPKSRKND |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol) |
| Gene ID | 25763 |
Más información
Human CXorf27 (NP_036406.1) full-length recombinant protein in yeast.