AB-P3794
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Size | 100 ug |
Gene Name | CXorf27 |
Gene Alias | 1700054O13Rik|HIP17|HYPM |
Gene Description | chromosome X open reading frame 27 |
Storage Conditions | Store at -20ºC. <br>Aliquot to avoid repeated freezing and thawing. |
Application Key | SDS-PAGE |
Immunogen Prot. Seq | MSEKKNCKNSSTNNNQTQDPSRNELQVPRSFVDRVVQDERDVQSQSSSTINTLLTLLDCLADYIMERVGLEASNNGSMRNTSQDREREVDNNREPHSAESDVTRFLFDEMPKSRKND |
Form | Liquid |
Antigen species Target species | Human |
Storage Buffer | In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol) |
Gene ID | 25763 |