Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
RETN (Human) Recombinant Protein
Abnova
RETN (Human) Recombinant Protein
Ref: AB-P3665
RETN (Human) Recombinant Protein
Contáctenos
Información del producto
Human RETN (Q9HD89, 17 a.a. - 108 a.a.) partial recombinant protein with Fc tag expressed in HEK cell.
Información adicional
Size
25 ug
Gene Name
RETN
Gene Alias
ADSF|FIZZ3|MGC126603|MGC126609|RETN1|RSTN|XCP1
Gene Description
resistin
Storage Conditions
Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Form
Lyophilized
Antigen species Target species
Human
Storage Buffer
Lyophilized from PBS
Gene ID
56729
Enviar un mensaje
RETN (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*