Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
RETN (Human) Recombinant Protein
Abnova
RETN (Human) Recombinant Protein
Ref: AB-P3665
RETN (Human) Recombinant Protein
Contacte-nos
Información del producto
Human RETN (Q9HD89, 17 a.a. - 108 a.a.) partial recombinant protein with Fc tag expressed in HEK cell.
Información adicional
Size
25 ug
Gene Name
RETN
Gene Alias
ADSF|FIZZ3|MGC126603|MGC126609|RETN1|RSTN|XCP1
Gene Description
resistin
Storage Conditions
Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Form
Lyophilized
Antigen species Target species
Human
Storage Buffer
Lyophilized from PBS
Gene ID
56729
Enviar uma mensagem
RETN (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*