Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
NGF (Human) Recombinant Protein
Abnova
NGF (Human) Recombinant Protein
Ref: AB-P3657
NGF (Human) Recombinant Protein
Contáctenos
Información del producto
Human NGF (P01138, 122 a.a. - 241 a.a.) partial recombinant protein expressed in CHO cells.
Información adicional
Size
20 ug
Gene Name
NGF
Gene Alias
Beta-NGF|HSAN5|MGC161426|MGC161428|NGFB
Gene Description
nerve growth factor (beta polypeptide)
Storage Conditions
Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Form
Lyophilized
Antigen species Target species
Human
Storage Buffer
Lyophilized from 20 mM sodium acetate, 150 mM NaCl, pH 5.5
Gene ID
4803
Enviar un mensaje
NGF (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*