View larger
Human NGF (P01138, 122 a.a. - 241 a.a.) partial recombinant protein expressed in CHO cells.
AB-P3657
New product
NGF (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | NGF |
| Gene Alias | Beta-NGF|HSAN5|MGC161426|MGC161428|NGFB |
| Gene Description | nerve growth factor (beta polypeptide) |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 20 mM sodium acetate, 150 mM NaCl, pH 5.5 |
| Gene ID | 4803 |
More info
Human NGF (P01138, 122 a.a. - 241 a.a.) partial recombinant protein expressed in CHO cells.