Ver mas grande
CCL4 (Human) Recombinant Protein
AB-P3652
Producto nuevo
CCL4 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | CCL4 |
| Gene Alias | ACT2|AT744.1|G-26|LAG1|MGC104418|MGC126025|MGC126026|MIP-1-beta|MIP1B|MIP1B1|SCYA2|SCYA4 |
| Gene Description | chemokine (C-C motif) ligand 4 |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from PBS |
| Gene ID | 6351 |
Más información
Human CCL4 (P13236, 24 a.a. - 92 a.a.) partial recombinant protein expressed in Escherichia coli.