AB-P3652
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Size | 10 ug |
Gene Name | CCL4 |
Gene Alias | ACT2|AT744.1|G-26|LAG1|MGC104418|MGC126025|MGC126026|MIP-1-beta|MIP1B|MIP1B1|SCYA2|SCYA4 |
Gene Description | chemokine (C-C motif) ligand 4 |
Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | Func,SDS-PAGE |
Immunogen Prot. Seq | APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN |
Form | Lyophilized |
Antigen species Target species | Human |
Storage Buffer | Lyophilized from PBS |
Gene ID | 6351 |