CXCL11 (Human) Recombinant Protein
  • CXCL11 (Human) Recombinant Protein

CXCL11 (Human) Recombinant Protein

Ref: AB-P3644
CXCL11 (Human) Recombinant Protein

Información del producto

Human CXCL11 (O14625, 22 a.a. - 94 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CXCL11
Gene Alias H174|I-TAC|IP-9|IP9|MGC102770|SCYB11|SCYB9B|b-R1
Gene Description chemokine (C-X-C motif) ligand 11
Storage Conditions Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 20 mM PB, 100 M NaCl, pH 7.5
Gene ID 6373

Enviar un mensaje


CXCL11 (Human) Recombinant Protein

CXCL11 (Human) Recombinant Protein