View larger
Human CXCL11 (O14625, 22 a.a. - 94 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P3644
New product
CXCL11 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | CXCL11 |
| Gene Alias | H174|I-TAC|IP-9|IP9|MGC102770|SCYB11|SCYB9B|b-R1 |
| Gene Description | chemokine (C-X-C motif) ligand 11 |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 20 mM PB, 100 M NaCl, pH 7.5 |
| Gene ID | 6373 |
More info
Human CXCL11 (O14625, 22 a.a. - 94 a.a.) partial recombinant protein expressed in Escherichia coli.