IL29 (Human) Recombinant Protein Ver mas grande

IL29 (Human) Recombinant Protein

AB-P3635

Producto nuevo

IL29 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 20 ug
Gene Name IL29
Gene Alias IFNL1|IL-29
Gene Description interleukin 29 (interferon, lambda 1)
Storage Conditions Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq TSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 20 mM PB, 130 mM NaCl, pH 7.5
Gene ID 282618

Más información

Human IL29 (Q8IU54 , 24 a.a. - 200 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

IL29 (Human) Recombinant Protein

IL29 (Human) Recombinant Protein