View larger
Human IL29 (Q8IU54 , 24 a.a. - 200 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P3635
New product
IL29 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | IL29 |
| Gene Alias | IFNL1|IL-29 |
| Gene Description | interleukin 29 (interferon, lambda 1) |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | TSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 20 mM PB, 130 mM NaCl, pH 7.5 |
| Gene ID | 282618 |
More info
Human IL29 (Q8IU54 , 24 a.a. - 200 a.a.) partial recombinant protein expressed in Escherichia coli.