Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
IL13 (Human) Recombinant Protein
Abnova
IL13 (Human) Recombinant Protein
Ref: AB-P3630
IL13 (Human) Recombinant Protein
Contáctenos
Información del producto
Human IL13 (P35225, 19 a.a. -132 a.a.) partial recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
10 ug
Gene Name
IL13
Gene Alias
ALRH|BHR1|IL-13|MGC116786|MGC116788|MGC116789|P600
Gene Description
interleukin 13
Storage Conditions
Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
SPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Form
Lyophilized
Antigen species Target species
Human
Storage Buffer
Lyophilized from PBS, pH 7.2
Gene ID
3596
Enviar un mensaje
IL13 (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*