View larger
Human IL13 (P35225, 19 a.a. -132 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P3630
New product
IL13 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | IL13 |
| Gene Alias | ALRH|BHR1|IL-13|MGC116786|MGC116788|MGC116789|P600 |
| Gene Description | interleukin 13 |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | SPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from PBS, pH 7.2 |
| Gene ID | 3596 |
More info
Human IL13 (P35225, 19 a.a. -132 a.a.) partial recombinant protein expressed in Escherichia coli.