CCL16 (Human) Recombinant Protein Ver mas grande

CCL16 (Human) Recombinant Protein

AB-P3620

Producto nuevo

CCL16 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 25 ug
Gene Name CCL16
Gene Alias CKb12|HCC-4|ILINCK|LCC-1|LEC|LMC|MGC117051|Mtn-1|NCC-4|NCC4|SCYA16|SCYL4
Gene Description chemokine (C-C motif) ligand 16
Storage Conditions Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 20 mM PB, 100 mM NaCl, pH 7.5
Gene ID 6360

Más información

Human CCL16 (O15467, 24 a.a. - 120 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

CCL16 (Human) Recombinant Protein

CCL16 (Human) Recombinant Protein