Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
CCL16 (Human) Recombinant Protein
Abnova
CCL16 (Human) Recombinant Protein
Ref: AB-P3620
CCL16 (Human) Recombinant Protein
Contacte-nos
Información del producto
Human CCL16 (O15467, 24 a.a. - 120 a.a.) partial recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
25 ug
Gene Name
CCL16
Gene Alias
CKb12|HCC-4|ILINCK|LCC-1|LEC|LMC|MGC117051|Mtn-1|NCC-4|NCC4|SCYA16|SCYL4
Gene Description
chemokine (C-C motif) ligand 16
Storage Conditions
Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Form
Lyophilized
Antigen species Target species
Human
Storage Buffer
Lyophilized from 20 mM PB, 100 mM NaCl, pH 7.5
Gene ID
6360
Enviar uma mensagem
CCL16 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*