View larger
Human CCL16 (O15467, 24 a.a. - 120 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P3620
New product
CCL16 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 25 ug |
| Gene Name | CCL16 |
| Gene Alias | CKb12|HCC-4|ILINCK|LCC-1|LEC|LMC|MGC117051|Mtn-1|NCC-4|NCC4|SCYA16|SCYL4 |
| Gene Description | chemokine (C-C motif) ligand 16 |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 20 mM PB, 100 mM NaCl, pH 7.5 |
| Gene ID | 6360 |
More info
Human CCL16 (O15467, 24 a.a. - 120 a.a.) partial recombinant protein expressed in Escherichia coli.