CCL24 (Human) Recombinant Protein
  • CCL24 (Human) Recombinant Protein

CCL24 (Human) Recombinant Protein

Ref: AB-P3604
CCL24 (Human) Recombinant Protein

Información del producto

Human CCL24 (O00175, 1 a.a. - 119 a.a.) full-length recombinant protein. expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CCL24
Gene Alias Ckb-6|MPIF-2|MPIF2|SCYA24
Gene Description chemokine (C-C motif) ligand 24
Storage Conditions Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilzed from 100 mM NaCl, 10 mM PB, pH 7.0
Gene ID 6369

Enviar un mensaje


CCL24 (Human) Recombinant Protein

CCL24 (Human) Recombinant Protein