View larger
Human CCL24 (O00175, 1 a.a. - 119 a.a.) full-length recombinant protein. expressed in <i>Escherichia coli</i>.
AB-P3604
New product
CCL24 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | CCL24 |
| Gene Alias | Ckb-6|MPIF-2|MPIF2|SCYA24 |
| Gene Description | chemokine (C-C motif) ligand 24 |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilzed from 100 mM NaCl, 10 mM PB, pH 7.0 |
| Gene ID | 6369 |
More info
Human CCL24 (O00175, 1 a.a. - 119 a.a.) full-length recombinant protein. expressed in Escherichia coli.