DIABLO (Human) Recombinant Protein
  • DIABLO (Human) Recombinant Protein

DIABLO (Human) Recombinant Protein

Ref: AB-P3525
DIABLO (Human) Recombinant Protein

Información del producto

Human DIABLO (NP_063940, 56 a.a. - 239 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name DIABLO
Gene Alias DIABLO-S|FLJ10537|FLJ25049|SMAC|SMAC3
Gene Description diablo homolog (Drosophila)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MASMTGGQQMGRGSMAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris, pH 7.5.
Gene ID 56616

Enviar un mensaje


DIABLO (Human) Recombinant Protein

DIABLO (Human) Recombinant Protein