Ver mas grande
DIABLO (Human) Recombinant Protein
AB-P3525
Producto nuevo
DIABLO (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | DIABLO |
| Gene Alias | DIABLO-S|FLJ10537|FLJ25049|SMAC|SMAC3 |
| Gene Description | diablo homolog (Drosophila) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MASMTGGQQMGRGSMAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris, pH 7.5. |
| Gene ID | 56616 |
Más información
Human DIABLO (NP_063940, 56 a.a. - 239 a.a.) partial recombinant protein expressed in Escherichia coli.