AB-P3525
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Size | 100 ug |
Gene Name | DIABLO |
Gene Alias | DIABLO-S|FLJ10537|FLJ25049|SMAC|SMAC3 |
Gene Description | diablo homolog (Drosophila) |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Concentration | 1 mg/mL |
Application Key | SDS-PAGE |
Immunogen Prot. Seq | MASMTGGQQMGRGSMAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED |
Form | Liquid |
Antigen species Target species | Human |
Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
Storage Buffer | In 20 mM Tris, pH 7.5. |
Gene ID | 56616 |