DIABLO (Human) Recombinant Protein View larger

Human DIABLO (NP_063940, 56 a.a. - 239 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

AB-P3525

New product

DIABLO (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 100 ug
Gene Name DIABLO
Gene Alias DIABLO-S|FLJ10537|FLJ25049|SMAC|SMAC3
Gene Description diablo homolog (Drosophila)
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MASMTGGQQMGRGSMAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris, pH 7.5.
Gene ID 56616

More info

Human DIABLO (NP_063940, 56 a.a. - 239 a.a.) partial recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human DIABLO (NP_063940, 56 a.a. - 239 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

Human DIABLO (NP_063940, 56 a.a. - 239 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.