Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
PRDX5 (Human) Recombinant Protein
Abnova
PRDX5 (Human) Recombinant Protein
Ref: AB-P3489
PRDX5 (Human) Recombinant Protein
Contáctenos
Información del producto
Human PRDX5 (NP_036226, 53 a.a. - 214 a.a.) partial recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
50 ug
Gene Name
PRDX5
Gene Alias
ACR1|AOEB166|B166|MGC117264|MGC142283|MGC142285|PLP|PMP20|PRDX6|PRXV|SBBI10
Gene Description
peroxiredoxin 5
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration
1 mg/mL
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
MAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Form
Liquid
Antigen species Target species
Human
Quality control testing
Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer
In 20 mM HEPES, pH 7.4.
Gene ID
25824
Enviar un mensaje
PRDX5 (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*