PRDX5 (Human) Recombinant Protein
  • PRDX5 (Human) Recombinant Protein

PRDX5 (Human) Recombinant Protein

Ref: AB-P3489
PRDX5 (Human) Recombinant Protein

Información del producto

Human PRDX5 (NP_036226, 53 a.a. - 214 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name PRDX5
Gene Alias ACR1|AOEB166|B166|MGC117264|MGC142283|MGC142285|PLP|PMP20|PRDX6|PRXV|SBBI10
Gene Description peroxiredoxin 5
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM HEPES, pH 7.4.
Gene ID 25824

Enviar uma mensagem


PRDX5 (Human) Recombinant Protein

PRDX5 (Human) Recombinant Protein