FKBP1A (Human) Recombinant Protein
  • FKBP1A (Human) Recombinant Protein

FKBP1A (Human) Recombinant Protein

Ref: AB-P3484
FKBP1A (Human) Recombinant Protein

Información del producto

Human FKBP1A (NP_463460, 1 a.a. - 108 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name FKBP1A
Gene Alias FKBP-12|FKBP1|FKBP12|FKBP12C|PKC12|PKCI2|PPIASE
Gene Description FK506 binding protein 1A, 12kDa
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 100 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol).
Gene ID 2280

Enviar un mensaje


FKBP1A (Human) Recombinant Protein

FKBP1A (Human) Recombinant Protein