Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
FKBP1A (Human) Recombinant Protein
Abnova
FKBP1A (Human) Recombinant Protein
Ref: AB-P3484
FKBP1A (Human) Recombinant Protein
Contacte-nos
Información del producto
Human FKBP1A (NP_463460, 1 a.a. - 108 a.a.) full-length recombinant protein with His tag expressed in
Escherichia coli
.
Información adicional
Size
100 ug
Gene Name
FKBP1A
Gene Alias
FKBP-12|FKBP1|FKBP12|FKBP12C|PKC12|PKCI2|PPIASE
Gene Description
FK506 binding protein 1A, 12kDa
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration
1 mg/mL
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Form
Liquid
Antigen species Target species
Human
Quality control testing
Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer
In 20 mM Tris-HCl buffer, 100 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol).
Gene ID
2280
Enviar uma mensagem
FKBP1A (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*