PPIH (Human) Recombinant Protein
  • PPIH (Human) Recombinant Protein

PPIH (Human) Recombinant Protein

Ref: AB-P3468
PPIH (Human) Recombinant Protein

Información del producto

Human PPIH (NP_006338, 1 a.a. - 177 a.a.) full-length recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name PPIH
Gene Alias CYP-20|CYPH|MGC5016|SnuCyp-20|USA-CYP
Gene Description peptidylprolyl isomerase H (cyclophilin H)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In PBS, pH 7.4 (10% glycerol).
Gene ID 10465

Enviar un mensaje


PPIH (Human) Recombinant Protein

PPIH (Human) Recombinant Protein