View larger
Human PPIH (NP_006338, 1 a.a. - 177 a.a.) full-length recombinant protein expressed in <i>Escherichia coli</i>.
AB-P3468
New product
PPIH (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | PPIH |
| Gene Alias | CYP-20|CYPH|MGC5016|SnuCyp-20|USA-CYP |
| Gene Description | peptidylprolyl isomerase H (cyclophilin H) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In PBS, pH 7.4 (10% glycerol). |
| Gene ID | 10465 |
More info
Human PPIH (NP_006338, 1 a.a. - 177 a.a.) full-length recombinant protein expressed in Escherichia coli.