DPP4 (Human) Recombinant Protein
  • DPP4 (Human) Recombinant Protein

DPP4 (Human) Recombinant Protein

Ref: AB-P3467
DPP4 (Human) Recombinant Protein

Información del producto

Human DPP4 (NP_001926, 39 a.a. - 766 a.a.) partial recombinant protein with His tag expressed in Hi-5 cell.
Información adicional
Size 100 ug
Gene Name DPP4
Gene Alias ADABP|ADCP2|CD26|DPPIV|TP103
Gene Description dipeptidyl-peptidase 4
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ADP-SRKTYTLTDYLKNTYRLKLYSLRWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNYVKQWRHSYTASYDIYDLNKRQLITE ERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPL IEYSFYSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQI
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl, 100 mM NaCl, 1 mM EDTA, pH 8.0 (10% glycerol).
Gene ID 1803

Enviar un mensaje


DPP4 (Human) Recombinant Protein

DPP4 (Human) Recombinant Protein