View larger
Human DPP4 (NP_001926, 39 a.a. - 766 a.a.) partial recombinant protein with His tag expressed in Hi-5 cell.
AB-P3467
New product
DPP4 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | DPP4 |
| Gene Alias | ADABP|ADCP2|CD26|DPPIV|TP103 |
| Gene Description | dipeptidyl-peptidase 4 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.5 mg/mL |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | ADP-SRKTYTLTDYLKNTYRLKLYSLRWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNYVKQWRHSYTASYDIYDLNKRQLITE ERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPL IEYSFYSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQI |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl, 100 mM NaCl, 1 mM EDTA, pH 8.0 (10% glycerol). |
| Gene ID | 1803 |
More info
Human DPP4 (NP_001926, 39 a.a. - 766 a.a.) partial recombinant protein with His tag expressed in Hi-5 cell.