Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
EGF (Human) Recombinant Protein
Abnova
EGF (Human) Recombinant Protein
Ref: AB-P3451
EGF (Human) Recombinant Protein
Contáctenos
Información del producto
Human EGF (NP_001954, 971 a.a. - 1023 a.a.) partial recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
100 ug
Gene Name
EGF
Gene Alias
HOMG4|URG
Gene Description
epidermal growth factor (beta-urogastrone)
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration
1 mg/mL
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Form
Liquid
Antigen species Target species
Human
Quality control testing
Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer
In PBS, pH 7.4.
Gene ID
1950
Enviar un mensaje
EGF (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*