View larger
Human EGF (NP_001954, 971 a.a. - 1023 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P3451
New product
EGF (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | EGF |
| Gene Alias | HOMG4|URG |
| Gene Description | epidermal growth factor (beta-urogastrone) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In PBS, pH 7.4. |
| Gene ID | 1950 |
More info
Human EGF (NP_001954, 971 a.a. - 1023 a.a.) partial recombinant protein expressed in Escherichia coli.