PTPN1 (Human) Recombinant Protein
  • PTPN1 (Human) Recombinant Protein

PTPN1 (Human) Recombinant Protein

Ref: AB-P3444
PTPN1 (Human) Recombinant Protein

Información del producto

Human PTPN1 (NP_002818, 1 a.a. - 321 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name PTPN1
Gene Alias PTP1B
Gene Description protein tyrosine phosphatase, non-receptor type 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRK
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 12% SDS-PAGE
Storage Buffer In 25 mM Tris-HCl, 1 mM EDTA, pH 7.5 (2 mM beta-mercaptoethanol, 1 mM DTT, 20% glycerol).
Gene ID 5770

Enviar un mensaje


PTPN1 (Human) Recombinant Protein

PTPN1 (Human) Recombinant Protein