View larger
Human PTPN1 (NP_002818, 1 a.a. - 321 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P3444
New product
PTPN1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | PTPN1 |
| Gene Alias | PTP1B |
| Gene Description | protein tyrosine phosphatase, non-receptor type 1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRK |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 12% SDS-PAGE |
| Storage Buffer | In 25 mM Tris-HCl, 1 mM EDTA, pH 7.5 (2 mM beta-mercaptoethanol, 1 mM DTT, 20% glycerol). |
| Gene ID | 5770 |
More info
Human PTPN1 (NP_002818, 1 a.a. - 321 a.a.) partial recombinant protein expressed in Escherichia coli.