Ver mas grande
LAMTOR2 (Human) Recombinant Protein
AB-P3418
Producto nuevo
LAMTOR2 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | ROBLD3 |
| Gene Alias | ENDAP|HSPC003|MAPBPIP|MAPKSP1AP|p14 |
| Gene Description | roadblock domain containing 3 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl buffer, 0.2 M Nacl, pH 8.0 (10% glycerol, 2 mM DTT). |
| Gene ID | 28956 |
Más información
Human LAMTOR2 (NP_054736, 1 a.a. - 125 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.