LAMTOR2 (Human) Recombinant Protein View larger

Human LAMTOR2 (NP_054736, 1 a.a. - 125 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

AB-P3418

New product

LAMTOR2 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 100 ug
Gene Name ROBLD3
Gene Alias ENDAP|HSPC003|MAPBPIP|MAPKSP1AP|p14
Gene Description roadblock domain containing 3
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 0.2 M Nacl, pH 8.0 (10% glycerol, 2 mM DTT).
Gene ID 28956

More info

Human LAMTOR2 (NP_054736, 1 a.a. - 125 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

Human LAMTOR2 (NP_054736, 1 a.a. - 125 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

Human LAMTOR2 (NP_054736, 1 a.a. - 125 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.