Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
FSCN1 (Human) Recombinant Protein
Abnova
FSCN1 (Human) Recombinant Protein
Ref: AB-P3409
FSCN1 (Human) Recombinant Protein
Contáctenos
Información del producto
Human FSCN1 (NP_003079, 1 a.a. - 493 a.a.) full-length recombinant protein with His tag at N-terminal expressed in
Escherichia coli
.
Información adicional
Size
100 ug
Gene Name
FSCN1
Gene Alias
FLJ38511|SNL|p55
Gene Description
fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus)
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration
1 mg/mL
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAVCLRSHLGRYLAADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHPQVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLAFQDQRYSVQTADHRFLRHDGRLVARPEPATGYTLEFRSGKVAFRDCEGRYLAPSG
Form
Liquid
Antigen species Target species
Human
Quality control testing
Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer
In 20 mM Tris-HCl buffer, 100 mM NaCl, pH 8.0 (2 mM DTT, 20% glycerol).
Gene ID
6624
Enviar un mensaje
FSCN1 (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*