View larger
Human FSCN1 (NP_003079, 1 a.a. - 493 a.a.) full-length recombinant protein with His tag at N-terminal expressed in <i>Escherichi
AB-P3409
New product
FSCN1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | FSCN1 |
| Gene Alias | FLJ38511|SNL|p55 |
| Gene Description | fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAVCLRSHLGRYLAADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHPQVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLAFQDQRYSVQTADHRFLRHDGRLVARPEPATGYTLEFRSGKVAFRDCEGRYLAPSG |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl buffer, 100 mM NaCl, pH 8.0 (2 mM DTT, 20% glycerol). |
| Gene ID | 6624 |
More info
Human FSCN1 (NP_003079, 1 a.a. - 493 a.a.) full-length recombinant protein with His tag at N-terminal expressed in Escherichia coli.