Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
S100Z (Human) Recombinant Protein
Abnova
S100Z (Human) Recombinant Protein
Ref: AB-P3405
S100Z (Human) Recombinant Protein
Contáctenos
Información del producto
Human S100Z (NP_570128, 1 a.a. - 99 a.a.) full-length recombinant protein with His tag at N-terminal expressed in
Escherichia coli
.
Información adicional
Size
100 ug
Gene Name
S100Z
Gene Alias
Gm625|S100-zeta
Gene Description
S100 calcium binding protein Z
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration
1 mg/mL
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMPTQLEMAMDTMIRIFHRYSGKERKRFKLSKGELKLLLQRELTEFLSCQKETQLVDKIVQDLDANKDNEVDFNEFVVMVAALTVACNDYFVEQLKKKGK
Form
Liquid
Antigen species Target species
Human
Quality control testing
Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer
In 20 mM Tris-HCl buffer, 1 mM EDTA, 50 mM NaCl, pH 8.0 (1 mM DTT, 20% glycerol).
Gene ID
170591
Enviar un mensaje
S100Z (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*