S100Z (Human) Recombinant Protein
  • S100Z (Human) Recombinant Protein

S100Z (Human) Recombinant Protein

Ref: AB-P3405
S100Z (Human) Recombinant Protein

Información del producto

Human S100Z (NP_570128, 1 a.a. - 99 a.a.) full-length recombinant protein with His tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name S100Z
Gene Alias Gm625|S100-zeta
Gene Description S100 calcium binding protein Z
Storage Conditions Store at 2C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMPTQLEMAMDTMIRIFHRYSGKERKRFKLSKGELKLLLQRELTEFLSCQKETQLVDKIVQDLDANKDNEVDFNEFVVMVAALTVACNDYFVEQLKKKGK
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 1 mM EDTA, 50 mM NaCl, pH 8.0 (1 mM DTT, 20% glycerol).
Gene ID 170591

Enviar uma mensagem


S100Z (Human) Recombinant Protein

S100Z (Human) Recombinant Protein